PDB entry 4gis

View 4gis on RCSB PDB site
Description: crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, glycerol and dicarboxylates bound (mixed loops, space group I4122)
Class: lyase
Keywords: ENOLASE, putative mannonate dehydratase, enzyme function initiative, EFI, Structural Genomics, LYASE
Deposited on 2012-08-08, released 2012-08-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.152
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0X4R4 (23-421)
      • expression tag (17-22)
    Domains in SCOPe 2.05: d4gisa1, d4gisa2
  • Chain 'B':
    Compound: enolase
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0X4R4 (23-421)
      • expression tag (17-22)
    Domains in SCOPe 2.05: d4gisb1, d4gisb2
  • Heterogens: CL, GOL, MLA, MG, MAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gisA (A:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gisA (A:)
    lyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdey
    lkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfg
    gksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgs
    yydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedil
    ppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklg
    hfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaepin
    gylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gisB (B:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gisB (B:)
    lyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdey
    lkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfg
    gksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfyniqtaqnptqgsyydqd
    qyientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilppsqt
    ewldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklghfces
    fgvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaepingylya
    seiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp