PDB entry 4gir

View 4gir on RCSB PDB site
Description: Crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group P41212)
Class: lyase
Keywords: ENOLASE, putative mannonate dehydratase, enzyme function initiative, EFI, Structural Genomics, LYASE
Deposited on 2012-08-08, released 2012-08-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.149
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gira1, d4gira2
  • Chain 'B':
    Compound: enolase
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0X4R4 (23-421)
      • expression tag (11-22)
    Domains in SCOPe 2.05: d4girb1, d4girb2
  • Chain 'C':
    Compound: enolase
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4girc1, d4girc2
  • Chain 'D':
    Compound: enolase
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0X4R4 (23-421)
      • expression tag (11-22)
    Domains in SCOPe 2.05: d4gird1, d4gird2
  • Heterogens: MG, SO4, CL, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4girA (A:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4girA (A:)
    kntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplligk
    danniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfggksrdaiq
    vythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsyydqdqyi
    entvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilppsqtewl
    dnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklghfcesfgv
    riawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaepingylyasei
    agigvemdreaaqdfpveyrphewtqsrlpdgsihtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4girB (B:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4girB (B:)
    dlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavk
    tmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmp
    lhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaq
    nptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpf
    fiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggit
    palklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpn
    aaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4girC (C:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4girC (C:)
    kntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplligk
    danniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfggksrdaiq
    vythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsyydqdqyi
    entvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilppsqtewl
    dnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklghfcesfgv
    riawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaepingylyasei
    agigvemdreaaqdfpveyrphewtqsrlpdgsihtp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4girD (D:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4girD (D:)
    dlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavk
    tmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmp
    lhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfypeniqtaqnpt
    qgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffie
    dilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpal
    klghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaae
    pingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp