PDB entry 4giq

View 4giq on RCSB PDB site
Description: Crystal Structure of mouse RANK bound to RANKL
Class: protein binding/protein binding
Keywords: RANK, ODFR, Activation-Induced Cytokine-Receptor, TNFRSF11A, RANKL, OPGL, TNF-like Cytokine, Cysteine-Rich Domain, Jelly-Roll fold, PROTEIN BINDING-PROTEIN BINDING complex
Deposited on 2012-08-08, released 2012-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor ligand superfamily member 11
    Species: Mus musculus [TaxId:10090]
    Gene: Opgl, Rankl, Tnfsf11, Trance
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4giqa_
  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 11A
    Species: Mus musculus [TaxId:10090]
    Gene: Rank, Tnfrsf11a
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, NA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4giqA (A:)
    gplgspefpgrrkpeaqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngkl
    rvnqdgfyylyanicfrhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsg
    nsefhfysinvggffklrageeisiqvsnpslldpdqdatyfgafkvqdid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4giqA (A:)
    qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
    rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
    lrageeisiqvsnpslldpdqdatyfgafkvqdid
    

  • Chain 'R':
    No sequence available.