PDB entry 4gib

View 4gib on RCSB PDB site
Description: 2.27 Angstrom Crystal Structure of beta-Phosphoglucomutase (pgmB) from Clostridium difficile
Class: isomerase
Keywords: Rossmann fold, HAD-like, beta-Phosphoglucomutase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, ISOMERASE
Deposited on 2012-08-08, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_21890, pgmB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q185X7 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.07: d4giba1, d4giba2
  • Chain 'B':
    Compound: beta-phosphoglucomutase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_21890, pgmB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gibb_
  • Heterogens: NA, PO4, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gibA (A:)
    mhhhhhhssgvdlgtenlyfqsnamieafifdldgvitdtayyhymawrklahkvgidid
    tkfneslkgisrmesldrilefgnkkysfseeekvrmaeeknnyyvslideitsndilpg
    iesllidvksnnikiglssasknainvlnhlgisdkfdfiadagkcknnkphpeiflmsa
    kglnvnpqncigiedasagidainsanmfsvgvgnyenlkkanlvvdstnqlkfeyiqek
    yneyivrrii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gibA (A:)
    amieafifdldgvitdtayyhymawrklahkvgididtkfneslkgisrmesldrilefg
    nkkysfseeekvrmaeeknnyyvslideitsndilpgiesllidvksnnikiglssaskn
    ainvlnhlgisdkfdfiadagkcknnkphpeiflmsakglnvnpqncigiedasagidai
    nsanmfsvgvgnyenlkkanlvvdstnqlkfeyiqekyneyivrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gibB (B:)
    mhhhhhhssgvdlgtenlyfqsnamieafifdldgvitdtayyhymawrklahkvgidid
    tkfneslkgisrmesldrilefgnkkysfseeekvrmaeeknnyyvslideitsndilpg
    iesllidvksnnikiglssasknainvlnhlgisdkfdfiadagkcknnkphpeiflmsa
    kglnvnpqncigiedasagidainsanmfsvgvgnyenlkkanlvvdstnqlkfeyiqek
    yneyivrrii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gibB (B:)
    mieafifdldgvitdtayyhymawrklahkvgididtkfneslkgisrmesldrilefgn
    kkysfseeekvrmaeeknnyyvslideitsndilpgiesllidvksnnikiglssaskna
    invlnhlgisdkfdfiadagkcknnkphpeiflmsakglnvnpqncigiedasagidain
    sanmfsvgvgnyenlkkanlvvdstnqlkfeyiqekyneyivr