PDB entry 4ghp

View 4ghp on RCSB PDB site
Description: Crystal Structure of D48V||A47D mutant of Human GLTP bound with 12:0 monosulfatide
Class: lipid transport
Keywords: GLTP-fold, LIPID TRANSPORT
Deposited on 2012-08-08, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZD2 (Start-208)
      • engineered mutation (46-47)
    Domains in SCOPe 2.07: d4ghpa_
  • Heterogens: EIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ghpA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikdvisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ghpA (A:)
    llkplpadkqietgpfleavshlppffdclgspvftpikdvisgnitkikavydtnpakf
    rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
    atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvny
    tatidviyemytqmnaelnykv