PDB entry 4gho

View 4gho on RCSB PDB site
Description: Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant
Class: hydrolase
Keywords: Structural Genomics, Enzyme Function Initiative, Alpha helix, three-stranded beta sheet, HYDROLASE
Deposited on 2012-08-08, released 2013-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.098
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: rnaSA, U39467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered mutation (23)
    Domains in SCOPe 2.07: d4ghoa_
  • Chain 'B':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: rnaSA, U39467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered mutation (23)
    Domains in SCOPe 2.07: d4ghob_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ghoA (A:)
dvsgtvclsalppeatdtlnliaadgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ghoB (B:)
dvsgtvclsalppeatdtlnliaadgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc