PDB entry 4ghh

View 4ghh on RCSB PDB site
Description: Structure of Homoprotocatechuate 2,3-Dioxygenase from B.fuscum in complex with 4-Nitrocatechol at 1.55 Ang resolution
Class: oxidoreductase
Keywords: Dioxygenase, oxygen activation, Fe(II), 2-His-1-carboxylate facial triad, homoprotocatechuate, 4-nitrocatechol, oxy complex, oxidoreductase
Deposited on 2012-08-07, released 2012-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.125
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: Brevibacterium fuscum [TaxId:47914]
    Gene: hpcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ghha1, d4ghha2
  • Chain 'B':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: Brevibacterium fuscum [TaxId:47914]
    Gene: hpcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ghhb1, d4ghhb2
  • Chain 'C':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: Brevibacterium fuscum [TaxId:47914]
    Gene: hpcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ghhc1, d4ghhc2
  • Chain 'D':
    Compound: homoprotocatechuate 2,3-dioxygenase
    Species: Brevibacterium fuscum [TaxId:47914]
    Gene: hpcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ghhd1, d4ghhd2
  • Heterogens: FE2, P6G, CL, CA, PG4, 4NC, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ghhA (A:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgfk
    lgnql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ghhA (A:)
    neipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihh
    nlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedpl
    gfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediq
    ddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrie
    rgpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvp
    swyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ghhB (B:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgfk
    lgnql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ghhB (B:)
    neipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihh
    nlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedpl
    gfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediq
    ddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrie
    rgpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvp
    swyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgfklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ghhC (C:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgfk
    lgnql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ghhC (C:)
    neipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihh
    nlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedpl
    gfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediq
    ddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrie
    rgpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvp
    swyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqask
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ghhD (D:)
    msneipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefi
    hhnlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrved
    plgfpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvted
    iqddegttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdr
    iergpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpv
    vpswyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgfk
    lgnql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ghhD (D:)
    eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
    lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
    fpyefffetthverlhmrydlysagelvrldhfnqvtpdvprgrkyledlgfrvtediqd
    degttyaawmhrkgtvhdtaltggngprlhhvafsthekhniiqicdkmgalrisdrier
    gpgrhgvsnafylyildpdnhrieiytqdyytgdpdnptitwnvhdnqrrdwwgnpvvps
    wyteaskvldldgnvqeiiertddselevtigadgfsftragdedgsyhgqaskgfklg