PDB entry 4ggh

View 4ggh on RCSB PDB site
Description: Crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, hepes, and ethylene glycol bound (ordered loops, space group c2221)
Class: hydrolase
Keywords: ENOLASE, putative mannonate dehydratase, enzyme function initiative, EFI, Structural Genomics, HYDROLASE
Deposited on 2012-08-06, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ggha1, d4ggha2
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gghb1, d4gghb2
  • Chain 'C':
    Compound: Putative uncharacterized protein
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gghc1, d4gghc2
  • Chain 'D':
    Compound: Putative uncharacterized protein
    Species: Vibrio harveyi [TaxId:673519]
    Gene: VME_00770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gghd1, d4gghd2
  • Heterogens: MG, EPE, EDO, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gghA (A:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gghA (A:)
    kntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplligk
    danniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfggksrdaiq
    vythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsyydqdqyi
    entvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilppsqtewl
    dnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklghfcesfgv
    riawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaepingylyasei
    agigvemdreaaqdfpveyrphewtqsrlpdgsihtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gghB (B:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gghB (B:)
    kntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplligk
    danniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfggksrdaiq
    vythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsyydqdqyi
    entvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilppsqtewl
    dnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklghfcesfgv
    riawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaepingylyasei
    agigvemdreaaqdfpveyrphewtqsrlpdgsihtp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gghC (C:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gghC (C:)
    kntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplligk
    danniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfggksrdaiq
    vythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsyydqdqyi
    entvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilppsqtewl
    dnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklghfcesfgv
    riawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaepingylyasei
    agigvemdreaaqdfpveyrphewtqsrlpdgsihtp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gghD (D:)
    mhhhhhhssgvdlgtenlyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygc
    atfqqrplavktmvdeylkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmal
    wdikakianmplhqlfggksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfy
    ggvpeniqtaqnptqgsyydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiq
    fakqieqynpffiedilppsqtewldnirnqssvslalgelfnnpeewkaliinrrvdfi
    rchvsqiggitpalklghfcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehve
    ykantqrvfpnaaepingylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsih
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gghD (D:)
    kntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplligk
    danniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfggksrdaiq
    vythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsyydqdqyi
    entvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilppsqtewl
    dnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklghfcesfgv
    riawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaepingylyasei
    agigvemdreaaqdfpveyrphewtqsrlpdgsihtp