PDB entry 4ggf

View 4ggf on RCSB PDB site
Description: Crystal structure of Mn2+ bound calprotectin
Class: antimicrobial protein
Keywords: S100, EF-hand, ANTIMICROBIAL PROTEIN
Deposited on 2012-08-06, released 2013-02-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • conflict (41)
    Domains in SCOPe 2.02: d4ggfa_
  • Chain 'C':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • conflict (41)
  • Chain 'L':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • conflict (41)
    Domains in SCOPe 2.02: d4ggfs_
  • Chain 'T':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • conflict (41)
    Domains in SCOPe 2.02: d4ggfu_
  • Chain 'V':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, MN, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ggfA (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ggfA (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'C':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4ggfS (S:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ggfS (S:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4ggfU (U:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ggfU (U:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksh
    

  • Chain 'V':
    No sequence available.