PDB entry 4gg7

View 4gg7 on RCSB PDB site
Description: Crystal structure of cMET in complex with novel inhibitor
Class: Transferase/Transferase inhibitor
Keywords: c-MET inhibitor, Transferase-Transferase inhibitor complex
Deposited on 2012-08-06, released 2012-10-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.21
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CMET, MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4gg7a_
  • Heterogens: 0J8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gg7A (A:)
    mgsshhhhhhgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrg
    hfgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgicl
    rsegsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaa
    rncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvw
    sfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemr
    psfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gg7A (A:)
    qavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnrigevsqflt
    egiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvkdligfgl
    qvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhnktgaklp
    vkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpe
    ycpdplyevmlkcwhpkaemrpsfselvsrisaifstf