PDB entry 4gg5

View 4gg5 on RCSB PDB site
Description: Crystal structure of CMET in complex with novel inhibitor
Class: transferase/transferase inhibitor
Keywords: CMET inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-08-05, released 2012-10-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: c-MET, MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4gg5a_
  • Heterogens: 0J3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gg5A (A:)
    mgsshhhhhhgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrg
    hfgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgicl
    rsegsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaa
    rncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvw
    sfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemr
    psfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gg5A (A:)
    qavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnritdiqflte
    giimkdfshpnvlsllgiclrsplvvlpymkhgdlrnfirnethnptvkdligfglqvak
    gmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhnktgaklpvkwm
    aleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpd
    plyevmlkcwhpkaemrpsfselvsrisaifstf