PDB entry 4gez

View 4gez on RCSB PDB site
Description: Structure of a neuraminidase-like protein from A/bat/Guatemala/164/2009
Class: viral protein
Keywords: influenza virus, coat protein, neuraminidase-like protein, VIRAL PROTEIN
Deposited on 2012-08-02, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4geza_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezd_
  • Chain 'E':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4geze_
  • Chain 'F':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezf_
  • Chain 'G':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezg_
  • Chain 'H':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezh_
  • Chain 'I':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezi_
  • Chain 'J':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezj_
  • Chain 'K':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezk_
  • Chain 'L':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gezl_
  • Heterogens: CA, NAG, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gezA (A:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezA (A:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gezB (B:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezB (B:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gezC (C:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezC (C:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gezD (D:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezD (D:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gezE (E:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezE (E:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4gezF (F:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezF (F:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4gezG (G:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezG (G:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4gezH (H:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezH (H:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4gezI (I:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezI (I:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4gezJ (J:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezJ (J:)
    raksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqhll
    ntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimiky
    geevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrwkq
    lnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfprg
    glttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvsls
    yelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvqni
    nwd
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4gezK (K:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezK (K:)
    wraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqhl
    lntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimik
    ygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrwk
    qlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfpr
    gglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvsl
    syelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvqn
    inwd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4gezL (L:)
    gsgdsgspgekfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfk
    ffiayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlv
    angrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhr
    iyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqi
    vepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleq
    ipngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqe
    lstfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gezL (L:)
    ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
    llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
    kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
    kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
    rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
    lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
    ninwd