PDB entry 4geo

View 4geo on RCSB PDB site
Description: P38a MAP kinase DEF-pocket penta mutant (M194A, L195A, H228A, I229A, Y258A)
Class: transferase
Keywords: docking site, substrate selectivity, Ser/Thr kinase, phosphorylation, TRANSFERASE
Deposited on 2012-08-02, released 2013-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.22
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered mutation (200-201)
      • engineered mutation (234-235)
      • engineered mutation (264)
    Domains in SCOPe 2.06: d4geoa_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4geoA (A:)
    mhhhhhhasqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavk
    klsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadl
    nnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglar
    htddemtgyvatrwyrapeiaanwmhynqtvdiwsvgcimaelltgrtlfpgtdaadqlk
    lilrlvgtpgaellkkissesarnaiqsltqmpkmnfanvfiganplavdllekmlvlds
    dkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl
    dqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4geoA (A:)
    rptfyrqelnktiwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrty
    relrllkhmkhenviglldvftparsleefndvylvthlmgadlnnikltddhvqfliyq
    ilrglkyihsadiihrdlkpsnlavnedcelkildfglatrwyrapeiaanwmhynqtvd
    iwsvgcimaelltgrtlfpgtdaadqlklilrlvgtpgaellkkissesarnaiqsltqm
    pkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydq
    sfesrdllidewksltydevisfvpp