PDB entry 4ge7

View 4ge7 on RCSB PDB site
Description: Kynurenine Aminotransferase II Inhibitors
Class: transferase/transferase inhibitor
Keywords: Aminotransferase, irreversible inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-08-01, released 2012-11-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: AADAT, KAT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N5Z0 (0-424)
      • engineered mutation (239-240)
      • expression tag (425-427)
    Domains in SCOPe 2.05: d4ge7a_
  • Chain 'B':
    Compound: kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: AADAT, KAT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N5Z0 (0-424)
      • engineered mutation (239-240)
      • expression tag (425-427)
    Domains in SCOPe 2.05: d4ge7b_
  • Heterogens: 0K5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ge7A (A:)
    mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfns
    grvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesllvprgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ge7A (A:)
    mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfns
    grvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesllvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ge7B (B:)
    mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfns
    grvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesllvprgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ge7B (B:)
    mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfns
    grvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesllvp