PDB entry 4gdj

View 4gdj on RCSB PDB site
Description: A subtype N10 neuraminidase-like protein of A/little yellow-shouldered bat/Guatemala/060/2010
Class: viral protein
Keywords: influenza virus, neuraminidase-like, n10, beta propeller, ectodomain, viral protein
Deposited on 2012-07-31, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129347]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdja_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129347]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdjb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129347]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdjc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129347]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdjd_
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gdjA (A:)
    gspsrkfywkarsqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsantlstsemilpgrsssacfdglkwtvlvsngrd
    rnsfimikygeeitdtfsasrggplrlpnsecicvegscfvlvsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkdlnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktktelsqngfvleqipdgi
    esegtvslsyelfsnkrtgrsgffqpkgdlisecqrvcfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdjA (A:)
    mcevkgwvpthrdlilsrrayvscdltscfkffiayglsaeeslyktpigsantlstsem
    ilpgrsssacfdglkwtvlvsngrdrnsfimikygeeitdtfsasrggplrlpnsecicv
    egscfvlvsdgpnvnqsvhriyelqngtvqrwkqlnttginfeystcytinnlikctgtn
    lwndakrpllrftkdlnyqivepcngaptdfprgglttpsckmaqekgeggiqgfildek
    pawtsktktelsqngfvleqipdgiesegtvslsyelfsnkrtgrsgffqpkgecqrvcf
    wleieiqelstfcgins
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gdjB (B:)
    gspsrkfywkarsqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsantlstsemilpgrsssacfdglkwtvlvsngrd
    rnsfimikygeeitdtfsasrggplrlpnsecicvegscfvlvsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkdlnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktktelsqngfvleqipdgi
    esegtvslsyelfsnkrtgrsgffqpkgdlisecqrvcfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdjB (B:)
    mcevkgwvpthrpgdlilsrrayvscdltscfkffiayglseeslyktpigsantlstse
    milpgrsssacfdglkwtvlvsngrdrnsfimikygeeitdtfsasrggplrlpnsecic
    vegscfvlvsdgpnvnqsvhriyelqngtvqrwkqlnttginfeystcytinnlikctgt
    nlwndakrpllrftkdlnyqivepcngaptdfprgglttpsckmaqekgeggiqgfilde
    kpawtsktktelsqngfvleqipdgiesegtvslsyelfsnkrtgrsgffqpkgecqrvc
    fwleieiqelstfcginspvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gdjC (C:)
    gspsrkfywkarsqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsantlstsemilpgrsssacfdglkwtvlvsngrd
    rnsfimikygeeitdtfsasrggplrlpnsecicvegscfvlvsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkdlnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktktelsqngfvleqipdgi
    esegtvslsyelfsnkrtgrsgffqpkgdlisecqrvcfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdjC (C:)
    mcevkgwvpthrdlilsrrayvscdltscfkffiayglseslyktpigsantlstsemil
    pgrsssacfdglkwtvlvsngrdrnsfimikygeeitdtfsasrggplrlpnsecicveg
    scfvlvsdgpnvnqsvhriyelqngtvqrwkqlnttginfeystcytinnlikctgtnlw
    ndakrpllrftkdlnyqivepcngaptdfprgglttpsckmaqekgeggiqgfildekpa
    wtsktktelsqngfvleqipdgiesegtvslsyelfsnkrtgrsgffqpkgecqrvcfwl
    eieqelstfcgins
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gdjD (D:)
    gspsrkfywkarsqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsantlstsemilpgrsssacfdglkwtvlvsngrd
    rnsfimikygeeitdtfsasrggplrlpnsecicvegscfvlvsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkdlnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktktelsqngfvleqipdgi
    esegtvslsyelfsnkrtgrsgffqpkgdlisecqrvcfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdjD (D:)
    cevkgwvpthrdlilsrrayvscdltscfkffiayglseslyktpigsantlstsemilp
    grsssacfdglkwtvlvsngrdrnsfimikygeeitdtfsasrggplrlpnsecicvegs
    cfvlvsdgpnvnqsvhriyelqngtvqrwkqlnttginfeystcytinnlikctgtnlwn
    dakrpllrftkdlnyqivepcngaptdfprgglttpsckmaqekgeggiqgfildekpaw
    tsktktelsqngfvleqipdgiesegtvslsyelfsnkrtgrsgffqpkgecqrvcfwle
    ieiqelstfcgins