PDB entry 4gdi

View 4gdi on RCSB PDB site
Description: A subtype N10 neuraminidase-like protein of A/little yellow-shouldered bat/Guatemala/164/2009
Class: viral protein
Keywords: influenza virus, neuraminidase-like, n10, beta-propeller, ectodomain, viral protein
Deposited on 2012-07-31, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.182
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdia_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdib_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdic_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdid_
  • Chain 'E':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdie_
  • Chain 'F':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129346]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gdif_
  • Heterogens: NAG, CA, GOL, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gdiA (A:)
    gspsrkfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrd
    rnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngi
    esegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdiA (A:)
    fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
    hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
    ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
    wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
    prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
    slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
    qninwds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gdiB (B:)
    gspsrkfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrd
    rnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngi
    esegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdiB (B:)
    fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
    hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
    ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
    wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
    prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
    slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
    qninwds
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gdiC (C:)
    gspsrkfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrd
    rnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngi
    esegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdiC (C:)
    fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
    hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
    ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
    wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
    prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
    slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
    qninwds
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gdiD (D:)
    gspsrkfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrd
    rnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngi
    esegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdiD (D:)
    fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
    hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
    ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
    wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
    prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
    slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
    qninwds
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gdiE (E:)
    gspsrkfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrd
    rnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngi
    esegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdiE (E:)
    fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
    hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
    ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
    wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
    prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
    slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
    qninwds
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4gdiF (F:)
    gspsrkfywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiay
    glsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrd
    rnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelq
    ngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcn
    gaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngi
    esegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfc
    ginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdiF (F:)
    fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
    hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
    ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
    wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
    prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
    slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
    qninwds