PDB entry 4gda

View 4gda on RCSB PDB site
Description: Circular Permuted Streptavidin A50/N49
Class: Biotin-binding protein
Keywords: biotin-binding protein, biotin, circular permutation
Deposited on 2012-07-31, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-End)
    • Uniprot P22629 (94-130)
      • linker (93)
    Domains in SCOPe 2.07: d4gdaa_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gdab_
  • Heterogens: BTN, GOL, SO4, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gdaA (A:)
    aesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwl
    ltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadga
    ltgtyesavgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdaA (A:)
    aesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwl
    ltsgtteanawkstlvghdtftkvkpsaeagitgtwynqlgstfivtagadgaltgtyes
    avgn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gdaB (B:)
    aesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwl
    ltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadga
    ltgtyesavgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gdaB (B:)
    aesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwl
    ltsgtteanawkstlvghdtftkvkpaeagitgtwynqlgstfivtagadgaltgtyesa
    vgn