PDB entry 4gd9

View 4gd9 on RCSB PDB site
Description: Circular Permuted Streptavidin N49/G48
Class: Biotin-Binding Protein
Keywords: biotin-binding protein, biotin, circular permutation
Deposited on 2012-07-31, released 2013-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.202
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gd9a_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (1-91)
    • Uniprot P22629 (96-131)
      • linker (92-95)
    Domains in SCOPe 2.06: d4gd9b_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (1-End)
    • Uniprot P22629 (96-131)
      • linker (95)
    Domains in SCOPe 2.06: d4gd9c_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gd9d_
  • Heterogens: BTN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gd9A (A:)
    mnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintq
    wlltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagad
    galtgtyesavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gd9A (A:)
    naesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqw
    lltsgtteanawkstlvghdtftkveagitgtwynqlgstfivtagadgaltgtyesavg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gd9B (B:)
    mnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintq
    wlltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagad
    galtgtyesavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gd9B (B:)
    naesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqw
    lltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadg
    altgtyesavg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gd9C (C:)
    mnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintq
    wlltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagad
    galtgtyesavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gd9C (C:)
    naesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqw
    lltsgtteanawkstlvghdtftkvksaeagitgtwynqlgstfivtagadgaltgtyes
    avg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gd9D (D:)
    mnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintq
    wlltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagad
    galtgtyesavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gd9D (D:)
    naesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqw
    lltsgtteanawkstlvghdtftkvkaeagitgtwynqlgstfivtagadgaltgtyesa
    vg