PDB entry 4gco

View 4gco on RCSB PDB site
Description: Central domain of stress-induced protein-1 (STI-1) from C.elegans
Class: protein binding
Keywords: structural genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, tetratricopeptide repeat domain, TPR domain, Hop, HSP70/HSP90-organising protein, co-chaperone, Hsp70, Hsp90, PROTEIN BINDING
Deposited on 2012-07-30, released 2012-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein STI-1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: CELE_R09E12.3, sti-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4gcoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gcoA (A:)
    snarlayinpelaqeeknkgneyfkkgdyptamrhyneavkrdpenailysnraacltkl
    mefqralddcdtcirldskfikgyirkaaclvamrewskaqrayedalqvdpsneeareg
    vrnclr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcoA (A:)
    yinpelaqeeknkgneyfkkgdyptamrhyneavkrdpenailysnraacltklmefqra
    lddcdtcirldskfikgyirkaaclvamrewskaqrayedalqvdpsneearegvrnclr