PDB entry 4gch

View 4gch on RCSB PDB site
Description: structure and activity of two photoreversible cinnamates bound to chymotrypsin
Deposited on 1989-09-25, released 1990-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1990-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d4gch__
  • Chain 'E':
    no info in PDB for this chain
  • Chain 'F':
    no info in PDB for this chain
  • Chain 'G':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >4gch_ (-)
    cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gch_ (-)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltrytpdrlqqaslpllsntnckkywgtkikdamicagasgv
    sscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.