PDB entry 4gb9

View 4gb9 on RCSB PDB site
Description: Potent and Highly Selective Benzimidazole Inhibitors of PI3K-delta
Class: transferase/transferase inhibitor
Keywords: kinase p110 gamma-isoform, kinase, lipid kinase, transferase-transferase inhibitor complex
Deposited on 2012-07-26, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4gb9a1, d4gb9a2, d4gb9a3, d4gb9a4, d4gb9a5
  • Heterogens: 0WR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gb9A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gb9A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmaeqdfvlrvc
    grdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgid
    ipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgall
    nlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisill
    dnhpiaaempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkw
    gqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlh
    yllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavile
    aylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsq
    lpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddl
    rqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgn
    tgafkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetg
    nlfhidfghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilf
    smmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlv