PDB entry 4gb1

View 4gb1 on RCSB PDB site
Description: Synthesis and Evaluation of Novel 3-C-alkylated-Neu5Ac2en Derivatives as Probes of Influenza Virus Sialidase 150-loop flexibility
Class: hydrolase
Keywords: Enzyme, Vial protein, Glycosylation, HYDROLASE
Deposited on 2012-07-26, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.208
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:385580]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07599 (0-End)
      • conflict (212)
    Domains in SCOPe 2.05: d4gb1a_
  • Heterogens: 0LP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gb1A (A:)
    tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
    khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
    vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
    iigqtdisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
    sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
    tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
    ssivmcgvdyevadwswhdgailpfdidkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gb1A (A:)
    tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
    khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
    vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
    iigqtdisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
    sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
    tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
    ssivmcgvdyevadwswhdgailpfdi