PDB entry 4gat

View 4gat on RCSB PDB site
Description: solution nmr structure of the wild type DNA binding domain of area complexed to a 13bp DNA containing a cgata site, regularized mean structure
Class: transcription/DNA
Keywords: DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA)
Deposited on 1997-11-07, released 1998-01-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nitrogen regulatory protein area
  Species: Emericella nidulans
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17429 (0-65)
    • conflict (0)
  Domains in SCOP 1.75: d4gata_
• Chain 'B':
  Compound: DNA (5'-d(*cp*ap*gp*cp*gp*ap*tp*ap*gp*ap*gp*ap*c)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*gp*tp*cp*tp*cp*tp*ap*tp*cp*gp*cp*tp*g)-3')
  
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4gatA (A:)
  mkngeqngpttctncftqttplwrrnpegqplcnacglflklhgvvrplslktdvikkrn
  rnsans
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.