PDB entry 4gal

View 4gal on RCSB PDB site
Description: crystal structure of human galectin-7 in complex with lactose
Deposited on 1998-07-13, released 1998-11-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-04, with a file datestamp of 1998-11-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d4gala_
  • Chain 'B':
    Domains in SCOP 1.55: d4galb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4galA (A:)
    snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
    fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
    vevggdvqldsvrif
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4galB (B:)
    snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
    fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
    vevggdvqldsvrif