PDB entry 4gal

View 4gal on RCSB PDB site
Description: crystal structure of human galectin-7 in complex with lactose
Class: lectin
Keywords: galaptin, lectin, galectin, carbohydrate binding
Deposited on 1998-07-13, released 1998-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gala_
  • Chain 'B':
    Compound: galectin-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4galb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4galA (A:)
    snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
    fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
    vevggdvqldsvrif
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4galB (B:)
    snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
    fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
    vevggdvqldsvrif