PDB entry 4gad

View 4gad on RCSB PDB site
Description: Crystal Structure of D230A/H234A Mutant of Stationary Phase Survival Protein (SurE) from Salmonella typhimurium
Class: hydrolase
Keywords: Stationary phase survival protein, Domain swapping, Rossmann fold, Phosphatase, HYDROLASE
Deposited on 2012-07-25, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.223
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'/3'-nucleotidase SurE
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM2927, surE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-End)
      • expression tag (11-13)
      • engineered mutation (243)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4gada1, d4gada2
  • Chain 'B':
    Compound: 5'/3'-nucleotidase SurE
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM2927, surE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (Start-266)
      • engineered mutation (243)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4gadb_
  • Heterogens: GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gadA (A:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamegrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvaltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gadA (A:)
    masmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfd
    ngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlg
    fpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcg
    srhadkvipqedprgntlywiggpdtdfaavdegyvsvtplhvaltaasahdvvsdwlds
    vgvgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gadB (B:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamegrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvaltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gadB (B:)
    illsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngdia
    vqmgtptdcvylgvnalmprpdivvsginagpnlgddviysgtvaaamegrhlgfpalav
    slngyqhydtaaavtcallrglstgrilnvnvpdlplaqvkgirvtrcgsrhpadkvipq
    edprgntlywigppgdydagpdtdfaavdegyvsvtplhvaltaasahdvvsdwldsvgv
    gtqw