PDB entry 4g9s

View 4g9s on RCSB PDB site
Description: Crystal structure of Escherichia coli PliG in complex with Atlantic salmon g-type lysozyme
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase inhibitor, lysozyme, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-07-24, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.129
AEROSPACI score: 1.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Goose-type lysozyme
  Species: Salmo salar [TaxId:8030]
  Gene: lysG, LYG
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6PZ97 (8-186)
    • expression tag (0-7)
    • engineered mutation (134)
  Domains in SCOPe 2.07: d4g9sa1, d4g9sa2
• Chain 'B':
  Compound: Inhibitor of g-type lysozyme
  Species: Escherichia coli [TaxId:562]
  Gene: pliG, ycgK
  Database cross-references and differences (RAF-indexed):
  • Uniprot P76002 (0-110)
• Heterogens: CL, FLC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4g9sA (A:)
  hhhhhhhmditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqk
  hgldpaiiagiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgte
  iliefirriqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsq
  wfksqgy
  

  
  
• Chain 'B':
  No sequence available.