PDB entry 4g9o

View 4g9o on RCSB PDB site
Description: Crystal Structure of H234A Mutant of Stationary Phase Survival Protein (SurE) from Salmonella typhimurium
Class: hydrolase
Keywords: Stationary phase survival protein, Domain swapping, Rossmann fold, Distorted dimer, Phosphatase, Hydrolase
Deposited on 2012-07-24, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'/3'-nucleotidase SurE
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM2927, surE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-End)
      • expression tag (13)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4g9oa1, d4g9oa2
  • Chain 'B':
    Compound: 5'/3'-nucleotidase SurE
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM2927, surE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4g9ob_
  • Heterogens: EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g9oA (A:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamegrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g9oA (A:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigpdtdfaavdegyvsvtplhvdltaasahdvvsdwldsvg
    vgtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4g9oB (B:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamegrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g9oB (B:)
    mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
    iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfpa
    lavslngyqhydtaaavtcallrglsrepltgrilnvnvpdlplaqvkgirvtrcgsrhp
    adkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahdvvs
    dwldsvgvgtqw