PDB entry 4g9b

View 4g9b on RCSB PDB site
Description: Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
Class: Isomerase
Keywords: HAD, putative phosphoglucomutase, enzyme function initiative, EFI, Structural Genomics, Isomerase
Deposited on 2012-07-23, released 2012-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: Escherichia coli [TaxId:83333]
    Gene: ycjU, b1317, JW1310
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77366 (2-220)
      • expression tag (1)
      • expression tag (221-227)
    Domains in SCOPe 2.07: d4g9ba1, d4g9ba2, d4g9ba3
  • Heterogens: MG, CL, SO4, UNL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g9bA (A:)
    mvmklqgvifdldgvitdtahlhfqawqqiaaeigisidaqfneslkgisrdeslrrilq
    hggkegdfnsqeraqlayrknllyvhslreltvnavlpgirslladlraqqisvglasvs
    lnaptilaalelrefftfcadasqlknskpdpeiflaacaglgvppqacigiedaqagid
    ainasgmrsvgigagltgaqlllpstesltwprlsafwqnvaenlyfqshhhhhhwshpq
    fek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g9bA (A:)
    vmklqgvifdldgvitdtahlhfqawqqiaaeigisidaqfneslkgisrdeslrrilqh
    ggkegdfnsqeraqlayrknllyvhslreltvnavlpgirslladlraqqisvglasvsl
    naptilaalelrefftfcadasqlknskpdpeiflaacaglgvppqacigiedaqagida
    inasgmrsvgigagltgaqlllpstesltwprlsafwqnvaenlyfq