PDB entry 4g94

View 4g94 on RCSB PDB site
Description: G1 ORF67 / Staphyloccus aureus sigmaA domain 4 complex
Class: DNA binding protein
Keywords: RNA polymerase binding protein, DNA BINDING PROTEIN
Deposited on 2012-07-23, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor rpoD
    Species: Staphylococcus aureus subsp. aureus [TaxId:93061]
    Gene: plaC, rpoD, SAOUHSC_01662, sigA, SigmaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0J0 (0-61)
      • conflict (0)
    Domains in SCOPe 2.07: d4g94a_
  • Chain 'B':
    Compound: orf067
    Species: Staphylococcus phage G1 [TaxId:292029]
    Gene: ORF67
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g94A (A:)
    mkeqledvldtltdreenvlrlrfglddgrtrtleevgkvfgvtrerirqieakalrklr
    hp
    

  • Chain 'B':
    No sequence available.