PDB entry 4g8x
View 4g8x on RCSB PDB site
Description: G1 ORF67 / Staphyloccus aureus sigmaA domain 4 complex
Class: DNA binding protein
Keywords: RNAP binding protein, DNA BINDING PROTEIN
Deposited on
2012-07-23, released
2013-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated
2013-08-07, with a file datestamp of
2013-08-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.285
AEROSPACI score: 0.16
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: RNA polymerase sigma factor rpoD
Species: Staphylococcus aureus subsp. aureus [TaxId:93061]
Gene: plaC, rpoD, SAOUHSC_01662, sigA, Sigma A domain 4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4g8xa_ - Chain 'B':
Compound: orf067
Species: Staphylococcus phage G1 [TaxId:292029]
Gene: ORF67
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: RNA polymerase sigma factor rpoD
Species: Staphylococcus aureus subsp. aureus [TaxId:93061]
Gene: plaC, rpoD, SAOUHSC_01662, sigA, Sigma A domain 4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4g8xc_ - Chain 'D':
Compound: orf067
Species: Staphylococcus phage G1 [TaxId:292029]
Gene: ORF67
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4g8xA (A:)
mkeqledvldtltdreenvlrlrfglddgrtrtleevgkvfgvtrerirqieakalrklr
hp
Sequence, based on observed residues (ATOM records): (download)
>4g8xA (A:)
mkeqledvldtltdreenvlrlrfglddgrtrtleevgkvfgvtrerirqieakalrklr
h
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>4g8xC (C:)
mkeqledvldtltdreenvlrlrfglddgrtrtleevgkvfgvtrerirqieakalrklr
hp
Sequence, based on observed residues (ATOM records): (download)
>4g8xC (C:)
dvldtltdreenvlrlrfglddgrtrtleevgkvfgtrerirqieakalrklrh
- Chain 'D':
No sequence available.