PDB entry 4g8t

View 4g8t on RCSB PDB site
Description: Crystal structure of a glucarate dehydratase related protein, from actinobacillus succinogenes, target EFI-502312, with sodium and sulfate bound, ordered loop
Class: Lyase
Keywords: ENOLASE, putative glucarate dehydratase, enzyme function initiative, EFI, Structural Genomics, Lyase
Deposited on 2012-07-23, released 2012-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.153
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: Asuc_1847
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g8ta1, d4g8ta2
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: Asuc_1847
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g8tb1, d4g8tb2
  • Chain 'C':
    Compound: glucarate dehydratase
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: Asuc_1847
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g8tc1, d4g8tc2
  • Chain 'D':
    Compound: glucarate dehydratase
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: Asuc_1847
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g8td1, d4g8td2
  • Heterogens: SO4, NA, GOL, DTU, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g8tA (A:)
    mhhhhhhssgvdlgtenlyfqsmstpiitemqvipvaghdsmllnlsgahspyftrnivi
    lkdnsgntgvgevpggekirqtledakplvigktlgeyknvmntvrqtfndhdaggrglq
    tfdlrttihvvtaieaamldllgqflgvtvasllgdgqqrdavemlgylffigdrkkttl
    ayqnqendpcdwyrvrheeamtpesvvrlaeaayekygfndfklkggvldgfeeaeavta
    lakrfpdaritldpngawsldeavkigkqlkgvlayaedpcgaeqgysgreimaefrrat
    glptatnmiatdwrqmghtislqsvdipladphfwtmqgsirvaqmchewgltwgshsnn
    hfdislamfthvaaaapgditaidthwiwqegnqrltkepfqikgglvevpkkpglgvel
    dmdqvmkanelyksmglgarddamamqflipgwkfdnkkpclvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g8tA (A:)
    stpiitemqvipvaghdsmllnlsgahspyftrnivilkdnsgntgvgevpggekirqtl
    edakplvigktlgeyknvmntvrqtfndhdaggrglqtfdlrttihvvtaieaamldllg
    qflgvtvasllgdgqqrdavemlgylffigdrkkttlayqnqendpcdwyrvrheeamtp
    esvvrlaeaayekygfndfklkggvldgfeeaeavtalakrfpdaritldpngawsldea
    vkigkqlkgvlayaedpcgaeqgysgreimaefrratglptatnmiatdwrqmghtislq
    svdipladphfwtmqgsirvaqmchewgltwgshsnnhfdislamfthvaaaapgditai
    dthwiwqegnqrltkepfqikgglvevpkkpglgveldmdqvmkanelyksmglgardda
    mamqflipgwkfdnkkpclvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4g8tB (B:)
    mhhhhhhssgvdlgtenlyfqsmstpiitemqvipvaghdsmllnlsgahspyftrnivi
    lkdnsgntgvgevpggekirqtledakplvigktlgeyknvmntvrqtfndhdaggrglq
    tfdlrttihvvtaieaamldllgqflgvtvasllgdgqqrdavemlgylffigdrkkttl
    ayqnqendpcdwyrvrheeamtpesvvrlaeaayekygfndfklkggvldgfeeaeavta
    lakrfpdaritldpngawsldeavkigkqlkgvlayaedpcgaeqgysgreimaefrrat
    glptatnmiatdwrqmghtislqsvdipladphfwtmqgsirvaqmchewgltwgshsnn
    hfdislamfthvaaaapgditaidthwiwqegnqrltkepfqikgglvevpkkpglgvel
    dmdqvmkanelyksmglgarddamamqflipgwkfdnkkpclvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g8tB (B:)
    stpiitemqvipvaghdsmllnlsgahspyftrnivilkdnsgntgvgevpggekirqtl
    edakplvigktlgeyknvmntvrqtfndhdaggrglqtfdlrttihvvtaieaamldllg
    qflgvtvasllgdgqqrdavemlgylffigdrkkttlayqnqendpcdwyrvrheeamtp
    esvvrlaeaayekygfndfklkggvldgfeeaeavtalakrfpdaritldpngawsldea
    vkigkqlkgvlayaedpcgaeqgysgreimaefrratglptatnmiatdwrqmghtislq
    svdipladphfwtmqgsirvaqmchewgltwgshsnnhfdislamfthvaaaapgditai
    dthwiwqegnqrltkepfqikgglvevpkkpglgveldmdqvmkanelyksmglgardda
    mamqflipgwkfdnkkpclvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4g8tC (C:)
    mhhhhhhssgvdlgtenlyfqsmstpiitemqvipvaghdsmllnlsgahspyftrnivi
    lkdnsgntgvgevpggekirqtledakplvigktlgeyknvmntvrqtfndhdaggrglq
    tfdlrttihvvtaieaamldllgqflgvtvasllgdgqqrdavemlgylffigdrkkttl
    ayqnqendpcdwyrvrheeamtpesvvrlaeaayekygfndfklkggvldgfeeaeavta
    lakrfpdaritldpngawsldeavkigkqlkgvlayaedpcgaeqgysgreimaefrrat
    glptatnmiatdwrqmghtislqsvdipladphfwtmqgsirvaqmchewgltwgshsnn
    hfdislamfthvaaaapgditaidthwiwqegnqrltkepfqikgglvevpkkpglgvel
    dmdqvmkanelyksmglgarddamamqflipgwkfdnkkpclvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g8tC (C:)
    stpiitemqvipvaghdsmllnlsgahspyftrnivilkdnsgntgvgevpggekirqtl
    edakplvigktlgeyknvmntvrqtfndhdaggrglqtfdlrttihvvtaieaamldllg
    qflgvtvasllgdgqqrdavemlgylffigdrkkttlayqnqendpcdwyrvrheeamtp
    esvvrlaeaayekygfndfklkggvldgfeeaeavtalakrfpdaritldpngawsldea
    vkigkqlkgvlayaedpcgaeqgysgreimaefrratglptatnmiatdwrqmghtislq
    svdipladphfwtmqgsirvaqmchewgltwgshsnnhfdislamfthvaaaapgditai
    dthwiwqegnqrltkepfqikgglvevpkkpglgveldmdqvmkanelyksmglgardda
    mamqflipgwkfdnkkpclvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4g8tD (D:)
    mhhhhhhssgvdlgtenlyfqsmstpiitemqvipvaghdsmllnlsgahspyftrnivi
    lkdnsgntgvgevpggekirqtledakplvigktlgeyknvmntvrqtfndhdaggrglq
    tfdlrttihvvtaieaamldllgqflgvtvasllgdgqqrdavemlgylffigdrkkttl
    ayqnqendpcdwyrvrheeamtpesvvrlaeaayekygfndfklkggvldgfeeaeavta
    lakrfpdaritldpngawsldeavkigkqlkgvlayaedpcgaeqgysgreimaefrrat
    glptatnmiatdwrqmghtislqsvdipladphfwtmqgsirvaqmchewgltwgshsnn
    hfdislamfthvaaaapgditaidthwiwqegnqrltkepfqikgglvevpkkpglgvel
    dmdqvmkanelyksmglgarddamamqflipgwkfdnkkpclvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g8tD (D:)
    stpiitemqvipvaghdsmllnlsgahspyftrnivilkdnsgntgvgevpggekirqtl
    edakplvigktlgeyknvmntvrqtfndhdaggrglqtfdlrttihvvtaieaamldllg
    qflgvtvasllgdgqqrdavemlgylffigdrkkttlayqnqendpcdwyrvrheeamtp
    esvvrlaeaayekygfndfklkggvldgfeeaeavtalakrfpdaritldpngawsldea
    vkigkqlkgvlayaedpcgaeqgysgreimaefrratglptatnmiatdwrqmghtislq
    svdipladphfwtmqgsirvaqmchewgltwgshsnnhfdislamfthvaaaapgditai
    dthwiwqegnqrltkepfqikgglvevpkkpglgveldmdqvmkanelyksmglgardda
    mamqflipgwkfdnkkpclvr