PDB entry 4g87

View 4g87 on RCSB PDB site
Description: Crystal structure of GLMU from Mycobacterium tuberculosis snapshot 1
Class: transferase
Keywords: acetyltransferase, bifunctional, pyrophosphorylase, rossmann-like fold, left-handed-beta-helix, cell shape, cell wall biogenesis/degradation, metal-binding, multifunctional enzyme, nucleotidyltransferase, peptidoglycan synthesis, acyltransferase, transferase
Deposited on 2012-07-22, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: glmU, MT1046, Rv1018c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g87a1, d4g87a2
  • Heterogens: MG, CO, UD1, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g87A (A:)
    hhhhhhmtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrliv
    vlghdhqriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgd
    tplldadtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsq
    reirevnagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsal
    vagvnnrvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllg
    rtqiggrcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgk
    lgafvevknstigtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrt
    gsdtmfvapvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqas
    krasemacqqptqppdadqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g87A (A:)
    dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
    lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
    liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
    afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
    elaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvg
    pdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafvevknst
    igtgtkvphltyvgdadigeysnigassvfvnrttvgshvrtgsdtmfvapvtigdgayt
    gagtvvredvppgalavsagpqrnienwvqrk