PDB entry 4g7t

View 4g7t on RCSB PDB site
Description: Rat Heme Oxygenase-1 in complex with Heme and CO with 1 hr Illumination: Laser on
Class: oxidoreductase
Keywords: all alpha protein, oxygenase, oxidoreductase
Deposited on 2012-07-20, released 2012-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HMOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g7ta_
  • Heterogens: HEM, FMT, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g7tA (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7tA (A:)
    qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
    npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
    ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
    mtpevkhrvteeaktafllnielfeelqallt