PDB entry 4g5p

View 4g5p on RCSB PDB site
Description: Crystal structure of EGFR kinase T790M in complex with BIBW2992
Class: transferase/transferase inhibitor
Keywords: EGF RECEPTOR KINASE MUTANT T790M, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-07-18, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: 0.247
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (3-End)
      • engineered mutation (97)
    Domains in SCOPe 2.04: d4g5pa_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (97)
    Domains in SCOPe 2.04: d4g5pb_
  • Heterogens: 0WN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g5pA (A:)
    gsmgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g5pA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgderdvvdadey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4g5pB (B:)
    gsmgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g5pB (B:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
    keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglaklkeyhakvpikwmale
    silhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvy
    mimvkcwmidadsrpkfreliiefskmardpqrylviqgdelptdsnfyralmdvvdade
    yli