PDB entry 4g5j

View 4g5j on RCSB PDB site
Description: Crystal structure of EGFR kinase in complex with BIBW2992
Class: transferase/transferase inhibitor
Keywords: PROTEIN KINASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-07-18, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.208
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4g5ja_
  • Heterogens: 0WN, 0WM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g5jA (A:)
    gsmgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g5jA (A:)
    geapnqallrilketefkkikvlgstvykglwipegekvkipvaikekeildeayvmasv
    dnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyle
    drrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmalesilhr
    iythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvk
    cwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmdd
    vvdadey