PDB entry 4g5i

View 4g5i on RCSB PDB site
Description: Crystal Structure of Porcine pancreatic PlA2 in complex with DBP
Class: hydrolase
Keywords: phospholipase a2, disulfide bond, hydrolase, 2 lipid degradation, lipoprotein, metal-binding, palmitate
Deposited on 2012-07-18, released 2012-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2, major isoenzyme
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-123)
  Domains in SCOPe 2.06: d4g5ia_
• Heterogens: CA, CL, DB7, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4g5iA (A:)
  alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
  ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
  kkyc