PDB entry 4g57

View 4g57 on RCSB PDB site
Description: Staphylococcal Nuclease double mutant I72L, I92L
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2012-07-17, released 2012-08-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-134)
      • engineered mutation (65)
      • engineered mutation (85)
    Domains in SCOPe 2.05: d4g57a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g57A (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
    enakklevefdkgqrtdkygrglaylyadgkmvnealvrqglakvayvykpnntheqhlr
    kseaqakkeklniws