PDB entry 4g55

View 4g55 on RCSB PDB site
Description: Clathrin terminal domain complexed with pitstop 2
Class: endocytosis
Keywords: Beta-Propeller, Endocytosis
Deposited on 2012-07-17, released 2012-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.174
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Clathrin heavy chain 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLH17, CLTC, CLTCL2, KIAA0034
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00610 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d4g55a1, d4g55a2, d4g55a3
  • Heterogens: DMS, ACT, EDO, PEG, VH2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g55A (A:)
    gspefmaqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidm
    ndpsnpirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwis
    lntvalvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqn
    rvvgamqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgt
    pptgnqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciym
    nrisgetifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrn
    nlagaeelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g55A (A:)
    fmaqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndps
    npirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntv
    alvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvg
    amqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptg
    nqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnris
    getifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnl