PDB entry 4g4q

View 4g4q on RCSB PDB site
Description: MutM containing F114A mutation bound to undamaged DNA
Class: Hydrolase/DNA
Keywords: DNA glycosylase, DNA repair, lesion recognition, base extrusion, disulfide crosslinking, Hydrolase-DNA complex
Deposited on 2012-07-16, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.18
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: mutM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84131 (0-272)
      • see remark 999 (1)
      • engineered mutation (112)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4g4qa1, d4g4qa2, d4g4qa3
  • Chain 'B':
    Compound: DNA (5'-d(*ap*gp*gp*tp*ap*gp*ap*cp*tp*cp*gp*gp*ap*cp*gp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*cp*gp*tp*cp*cp*gp*ap*gp*(tx2)p*cp*tp*ap*cp*c)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g4qA (A:)
    pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
    lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkagtmhvya
    keeadrrpplaelgpeplspafspavlaeravktkrsvkallldctvvagfgniyvdesl
    fragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhlyv
    ygrqgnpckrcgtpiektvvagrgthycprcqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g4qA (A:)
    pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
    lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkagtmhvya
    keeadrrpplaelgpeplspafspavlaeravktkrsvkallldctvvagfgniyvdesl
    fragilpgrpaaslsskeierlheemvatigeavmkhhlyvygrqgnpckrcgtpiektv
    vagrgthycprcqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.