PDB entry 4g4f

View 4g4f on RCSB PDB site
Description: Crystal structure of GITRL from Bushbaby
Class: immune system
Keywords: GLUCOCORTICOID-INDUCED TNF RECEPTOR LIGAND, IMMUNE SYSTEM, TNFRSF18, Structural genomics, PSI-biology, New York Structural Genomics Research Consortium (NYSGRC)
Deposited on 2012-07-16, released 2012-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.209
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Otolemur garnettii [TaxId:30611]
    Gene: Gitrl
    Database cross-references and differences (RAF-indexed):
    • PDB 4G4F (Start-125)
    Domains in SCOPe 2.07: d4g4fa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g4fA (A:)
    ghtankpclakfelltskwqmtsrkppcvnslpegklkilqdglyliygqvapstaykgv
    apfavqlrkneamlqtltsnstiydvggtyefhagdiidlifddehqvlknntywgivll
    anlfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g4fA (A:)
    kpclakfelltskwqmtsrkppcvnslpegklkilqdglyliygqvapspfavqlrknea
    mlqtltsnstiydvggtyefhagdiidlifddehqvlknntywgivllanlfis