PDB entry 4g4e

View 4g4e on RCSB PDB site
Description: Crystal structure of the L88A mutant of HslV from Escherichia coli
Class: hydrolase
Keywords: ATP-dependent Protease, HslU ATPase, HslV protease, HslVU, Pore Motif, HYDROLASE
Deposited on 2012-07-16, released 2013-06-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.259
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4g4ec_
  • Chain 'D':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4g4ee_
  • Chain 'F':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ATP-dependent protease subunit HslV
    Species: Escherichia coli [TaxId:83333]
    Gene: HslV
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4g4eC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmarkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g4eC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrrkleallavadetasliitgngdvvqpendliaigsg
    gpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4g4eE (E:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmarkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g4eE (E:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrrkleallavadetasliitgngdvvqpendliaigsg
    gpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.