PDB entry 4g2w

View 4g2w on RCSB PDB site
Description: Crystal structure of PDE5A in complex with its inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: phosphodiesterase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-07-13, released 2013-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.19
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5, PDE5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g2wa_
  • Heterogens: NI0, MG, PEG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g2wA (A:)
    mgsshhhhhhssglvprgshmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletal
    ctirmftdlnlvqnfqmkhevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagk
    iqnkltdleilalliaalshdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmil
    nspgnqilsglsieeykttlkiikqailatdlalyikrrgeffelirknqfnledphqke
    lflamlmtacdlsaitkpwpiqqriaelvateffdqgdrerkelnieptdlmnrekknki
    psmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g2wA (A:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hrgvnnssimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdlalyikr
    rgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvateffdqnk
    ipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalae