PDB entry 4g1k

View 4g1k on RCSB PDB site
Description: Crystal structure of triosephosphate isomerase from Burkholderia thailandensis
Class: isomerase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TIM barrel, tpiA, D-glyceraldehyde 3-phosphate, glycerone phosphate, gluconeogenesis, glycolysis, ISOMERASE
Deposited on 2012-07-10, released 2012-07-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.171
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1058, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4g1ka_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1058, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4g1kb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1058, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4g1kc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1058, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4g1kd_
  • Heterogens: NA, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g1kA (A:)
    mahhhhhhmgtleaqtqgpgsmskqrikrvignwkmhgrlsgnqalltevaqgaqavhdn
    vaigvcvpfpylaqaqaqlqggrvswgsqdvsaheqgaytgevaagmvaefgaayaivgh
    serrayhgesnetvaakarralaagltpivcvgetlaereagtteqvvgaqldavlavls
    pdeaarivvayepvwaigtgksataeqaqqvhaflrgrlaakgaghvsllyggsvkadna
    aelfgqpdidggliggaslksgdflaicraak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g1kA (A:)
    qrikrvignwkmhgrlsgnqalltevaqgaqavhdnvaigvcvpfpylaqaqaqlqggrv
    swgsqdvsaheqgaytgevaagmvaefgaayaivghserrayhgesnetvaakarralaa
    gltpivcvgetlaereagtteqvvgaqldavlavlspdeaarivvayepvwaigtgksat
    aeqaqqvhaflrgrlaakgaghvsllyggsvkadnaaelfgqpdidggliggaslksgdf
    laicraak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4g1kB (B:)
    mahhhhhhmgtleaqtqgpgsmskqrikrvignwkmhgrlsgnqalltevaqgaqavhdn
    vaigvcvpfpylaqaqaqlqggrvswgsqdvsaheqgaytgevaagmvaefgaayaivgh
    serrayhgesnetvaakarralaagltpivcvgetlaereagtteqvvgaqldavlavls
    pdeaarivvayepvwaigtgksataeqaqqvhaflrgrlaakgaghvsllyggsvkadna
    aelfgqpdidggliggaslksgdflaicraak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g1kB (B:)
    qrikrvignwkmhgrlsgnqalltevaqgaqavhdnvaigvcvpfpylaqaqaqlqggrv
    swgsqdvsaheqgaytgevaagmvaefgaayaivghserrayhgesnetvaakarralaa
    gltpivcvgetlaereagtteqvvgaqldavlavlspdeaarivvayepvwaigtgksat
    aeqaqqvhaflrgrlaakgaghvsllyggsvkadnaaelfgqpdidggliggaslksgdf
    laicraak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4g1kC (C:)
    mahhhhhhmgtleaqtqgpgsmskqrikrvignwkmhgrlsgnqalltevaqgaqavhdn
    vaigvcvpfpylaqaqaqlqggrvswgsqdvsaheqgaytgevaagmvaefgaayaivgh
    serrayhgesnetvaakarralaagltpivcvgetlaereagtteqvvgaqldavlavls
    pdeaarivvayepvwaigtgksataeqaqqvhaflrgrlaakgaghvsllyggsvkadna
    aelfgqpdidggliggaslksgdflaicraak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g1kC (C:)
    qrikrvignwkmhgrlsgnqalltevaqgaqavhdnvaigvcvpfpylaqaqaqlqggrv
    swgsqdvsaheqgaytgevaagmvaefgaayaivghserrayhgesnetvaakarralaa
    gltpivcvgetlaereagtteqvvgaqldavlavlspdeaarivvayepvwaigtgksat
    aeqaqqvhaflrgrlaakgaghvsllyggsvkadnaaelfgqpdidggliggaslksgdf
    laicraak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4g1kD (D:)
    mahhhhhhmgtleaqtqgpgsmskqrikrvignwkmhgrlsgnqalltevaqgaqavhdn
    vaigvcvpfpylaqaqaqlqggrvswgsqdvsaheqgaytgevaagmvaefgaayaivgh
    serrayhgesnetvaakarralaagltpivcvgetlaereagtteqvvgaqldavlavls
    pdeaarivvayepvwaigtgksataeqaqqvhaflrgrlaakgaghvsllyggsvkadna
    aelfgqpdidggliggaslksgdflaicraak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g1kD (D:)
    qrikrvignwkmhgrlsgnqalltevaqgaqavhdnvaigvcvpfpylaqaqaqlqggrv
    swgsqdvsaheqgaytgevaagmvaefgaayaivghserrayhgesnetvaakarralaa
    gltpivcvgetlaereagtteqvvgaqldavlavlspdeaarivvayepvwaataeqaqq
    vhaflrgrlaakgaghvsllyggsvkadnaaelfgqpdidggliggaslksgdflaicra
    ak