PDB entry 4g16

View 4g16 on RCSB PDB site
Description: Crystal structure of ck1g3 with 2-[(4-{[3-(TRIFLUOROMETHYL)PYRIDIN2-YL]OXY}PHENYL)AMINO]-1H-BENZIMIDAZOLE-6-CARBONITRILE
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: ck1g, kinase, inhibitor, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2012-07-10, released 2013-05-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.237
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase I isoform gamma-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1G3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6M4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d4g16a_
  • Heterogens: 0VM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g16A (A:)
    gsgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykq
    lgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmey
    vhsknliyrdvkpenfligrpgnktqqvihiidfglakeyidpetkkhipyrehksltgt
    arymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratp
    ievlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlpt
    pvgavqqdpalssnreahqhrdkmqqsknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g16A (A:)
    gsgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykq
    lgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmey
    vhsknliyrdvkpenfligrpgnktqqvihiidfglakeyidpetkkhipyrehksltgt
    arymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratp
    ievlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlpt
    pv