PDB entry 4g0y

View 4g0y on RCSB PDB site
Description: Crystal structure of Arabidopsis AGO1 in complex with AMP
Class: gene regulation
Keywords: MID domain, GENE REGULATION
Deposited on 2012-07-10, released 2012-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-12, with a file datestamp of 2012-09-07.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.182
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein argonaute 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AGO1, At1g48410, F11A17.3, T1N15.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04379 (1-146)
      • expression tag (0)
    Domains in SCOPe 2.08: d4g0ya1, d4g0ya2
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g0yA (A:)
    snkkminggtvnnwicinfsrqvqdnlartfcqelaqmcyvsgmafnpepvlppvsarpe
    qvekvlktryhdatsklsqgkeidllivilpdnngslygdlkricetelgivsqccltkh
    vfkmskqymanvalkinvkvggrntvl