PDB entry 4g0d

View 4g0d on RCSB PDB site
Description: Human collagenase 3 (MMP-13) full form with peptides from pro-domain
Class: hydrolase
Keywords: protein-peptide complex, collagenase, cleavage with mmp3, hydrolase, pro-peptide, metzincin, Zinc metalloprotease, collagen cleavage, collagen
Deposited on 2012-07-09, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.172
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagenase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45452 (0-367)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d4g0da1, d4g0da2
  • Chain 'B':
    Compound: collagenase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45452 (0-367)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d4g0db1, d4g0db2
  • Chain 'C':
    Compound: collagenase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45452 (0-367)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d4g0dc1, d4g0dc2
  • Chain 'D':
    Compound: collagenase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45452 (0-367)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d4g0dd1, d4g0dd2
  • Chain 'W':
    Compound: Collagenase 3, pro-domain peptide
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP13
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Collagenase 3, pro-domain peptide
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP13
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Collagenase 3, pro-domain peptide
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP13
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Collagenase 3, pro-domain peptide
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP13
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CA, CL, PGO, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g0dA (A:)
    ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
    misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha
    fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnpkhpktpdk
    cdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnridaayehpsh
    dlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktllfsgnqvw
    ryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiwsnrivrvm
    pansilwc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g0dB (B:)
    ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
    misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha
    fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnpkhpktpdk
    cdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnridaayehpsh
    dlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktllfsgnqvw
    ryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiwsnrivrvm
    pansilwc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g0dC (C:)
    ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
    misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha
    fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnpkhpktpdk
    cdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnridaayehpsh
    dlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktllfsgnqvw
    ryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiwsnrivrvm
    pansilwc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g0dD (D:)
    ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
    misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha
    fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnpkhpktpdk
    cdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnridaayehpsh
    dlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktllfsgnqvw
    ryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiwsnrivrvm
    pansilwc
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.