PDB entry 4fzw

View 4fzw on RCSB PDB site
Description: Crystal Structure of the PaaF-PaaG Hydratase-Isomerase Complex from E.coli
Class: isomerase/lyase
Keywords: Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, crotonase fold, enzymes of the phenylacetate degradation pathway, ISOMERASE-LYASE complex
Deposited on 2012-07-08, released 2012-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-dehydroadipyl-CoA hydratase
    Species: Escherichia coli [TaxId:83333]
    Gene: b1393, JW1388, paaF, ydbR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fzwa_
  • Chain 'B':
    Compound: 2,3-dehydroadipyl-CoA hydratase
    Species: Escherichia coli [TaxId:83333]
    Gene: b1393, JW1388, paaF, ydbR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76082 (3-257)
      • expression tag (2)
    Domains in SCOPe 2.07: d4fzwb1, d4fzwb2
  • Chain 'C':
    Compound: 1,2-epoxyphenylacetyl-CoA isomerase
    Species: Escherichia coli [TaxId:83333]
    Gene: paaG, ydbT, b1394, JW1389
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fzwc_
  • Chain 'D':
    Compound: 1,2-epoxyphenylacetyl-CoA isomerase
    Species: Escherichia coli [TaxId:83333]
    Gene: paaG, ydbT, b1394, JW1389
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fzwd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fzwA (A:)
    mrsmselivsrqqrvllltlnrpaarnalnnallmqlvneleaaatdtsisvcvitgnar
    ffaagadlnemaekdlaatlndtrpqlwarlqafnkpliaavngyalgagcelallcdvv
    vagenarfglpeitlgimpgaggtqrlirsvgkslaskmvlsgesitaqqaqqaglvsdv
    fpsdltleyalqlaskmarhsplalqaakqalrqsqevalqaglaqerqlftllaatedr
    hegisaflqkrtpdfkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fzwA (A:)
    selivsrqqrvllltlnrpaarnalnnallmqlvneleaaatdtsisvcvitgnarffaa
    gadlnemaekdlaatlndtrpqlwarlqafnkpliaavngyalgagcelallcdvvvage
    narfglpeitlgimpgaggtqrlirsvgkslaskmvlsgesitaqqaqqaglvsdvfpsd
    ltleyalqlaskmarhsplalqaakqalrqsqevalqaglaqerqlftllaatedrhegi
    saflqkrtpdfkgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fzwB (B:)
    mrsmselivsrqqrvllltlnrpaarnalnnallmqlvneleaaatdtsisvcvitgnar
    ffaagadlnemaekdlaatlndtrpqlwarlqafnkpliaavngyalgagcelallcdvv
    vagenarfglpeitlgimpgaggtqrlirsvgkslaskmvlsgesitaqqaqqaglvsdv
    fpsdltleyalqlaskmarhsplalqaakqalrqsqevalqaglaqerqlftllaatedr
    hegisaflqkrtpdfkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fzwB (B:)
    smselivsrqqrvllltlnrpaarnalnnallmqlvneleaaatdtsisvcvitgnarff
    aagadlnemaekdlaatlndtrpqlwarlqafnkpliaavngyalgagcelallcdvvva
    genarfglpeitlgimpgaggtqrlirsvgkslaskmvlsgesitaqqaqqaglvsdvfp
    sdltleyalqlaskmarhsplalqaakqalrqsqevalqaglaqerqlftllaatedrhe
    gisaflqkrtpdfkgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fzwC (C:)
    mgsshhhhhhgsmmefilshvekgvmtltlnrperlnsfndemhaqlaeclkqverddti
    rcllltgagrgfcagqdlndrnvdptgpapdlgmsverfynplvrrlaklpkpvicavng
    vaagagatlalggdiviaarsakfvmafsklglipdcggtwllprvagraramglallgn
    qlsaeqahewgmiwqvvddetladtaqqlarhlatqptfglglikqainsaetntldtql
    dlerdyqrlagrsadyregvsaflakrspqftgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fzwC (C:)
    filshvekgvmtltlnrperlnsfndemhaqlaeclkqverddtircllltgagrgfcag
    qdlnapdlgmsverfynplvrrlaklpkpvicavngvaagagatlalggdiviaarsakf
    vmafsklglipdcggtwllprvagraramglallgnqlsaeqahewgmiwqvvddetlad
    taqqlarhlatqptfglglikqainsaetntldtqldlerdyqrlagrsadyregvsafl
    arspqftgk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fzwD (D:)
    mgsshhhhhhgsmmefilshvekgvmtltlnrperlnsfndemhaqlaeclkqverddti
    rcllltgagrgfcagqdlndrnvdptgpapdlgmsverfynplvrrlaklpkpvicavng
    vaagagatlalggdiviaarsakfvmafsklglipdcggtwllprvagraramglallgn
    qlsaeqahewgmiwqvvddetladtaqqlarhlatqptfglglikqainsaetntldtql
    dlerdyqrlagrsadyregvsaflakrspqftgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fzwD (D:)
    filshvekgvmtltlnrperlnsfndemhaqlaeclkqverddtircllltgagrgfcag
    qdlnapdlgmsverfynplvrrlaklpkpvicavngvaagagatlalggdiviaarsakf
    vmafsklglipdcggtwllprvagraramglallgnqlsaeqahewgmiwqvvddetlad
    taqqlarhlatqptfglglikqainsaetntldtqldlerdyqrlagrsadyregvsafl
    akrspqftgk