PDB entry 4fzo

View 4fzo on RCSB PDB site
Description: Crystal Structure of the apo-form uranyl binding protein
Class: unknown function
Keywords: uranyl binding, uranyl, UNKNOWN FUNCTION
Deposited on 2012-07-06, released 2013-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.16
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: uranyl binding protein
  Species: Methanothermobacter thermautotrophicus [TaxId:187420]
  Gene: MTH_1690
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27725 (4-79)
    • expression tag (0-3)
    • engineered mutation (15)
    • engineered mutation (19)
    • engineered mutation (66)
    • engineered mutation (69)
    • expression tag (80-81)
  Domains in SCOPe 2.08: d4fzoa1, d4fzoa2, d4fzoa3
• Chain 'B':
  Compound: uranyl binding protein
  Species: Methanothermobacter thermautotrophicus [TaxId:187420]
  Gene: MTH_1690
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27725 (4-79)
    • expression tag (2-3)
    • engineered mutation (15)
    • engineered mutation (19)
    • engineered mutation (66)
    • engineered mutation (69)
    • expression tag (80-81)
  Domains in SCOPe 2.08: d4fzob1, d4fzob2, d4fzob3
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fzoA (A:)
  snaldcreriekdledlekelmemksiklsddeeavveralnyrddsvyylekgdhitsf
  gcityaegltdslrmlhriieg
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4fzoB (B:)
  snaldcreriekdledlekelmemksiklsddeeavveralnyrddsvyylekgdhitsf
  gcityaegltdslrmlhriieg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4fzoB (B:)
  aldcreriekdledlekelmemksiklsddeeavveralnyrddsvyylekgdhitsfgc
  ityaegltdslrmlhriieg