PDB entry 4fze

View 4fze on RCSB PDB site
Description: Crystal structure of N26_i1 Fab, an ADCC mediating anti-HIV-1 antibody.
Class: immune system
Keywords: ADCC, ANTI-HIV-1 ENV ANTIBODY N26_i1, VIRAL GLYCOPROTEIN GP120, HIV-1 ENV, IMMUNE SYSTEM, CD4I ANTIBODY, FAB
Deposited on 2012-07-06, released 2013-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: N26_i1 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4FZE (0-End)
  • Chain 'L':
    Compound: N26_i1 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4FZE
    Domains in SCOPe 2.07: d4fzel1, d4fzel2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fzeL (L:)
    qsvltqppsvsvspgqtasitcsgdnlrdgyaswyqqkpgqspvlviyrddkrpsgiper
    fsgsssgntailtlsgaqamdeadyycqawasttvifgggtrltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fzeL (L:)
    svltqppsvsvspgqtasitcsgdnlrdgyaswyqqkpgqspvlviyrddkrpsgiperf
    sgsssgntailtlsgaqamdeadyycqawasttvifgggtrltvlgqpkaapsvtlfpps
    seelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylslt
    peqwkshrsyscqvthegstvektvapte